Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB1M Peptide - C-terminal region

TFB1M Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI75, mtTFB, CGI-75, mtTFB1

UniProt

Q8WVM0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFB1M Rabbit Polyclonal Antibody (orb588373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057104.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SISHFKSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular Endothelial Growth Factor C Human Recombinant
rAP-2504 1 Each

Vascular Endothelial Growth Factor C Human Recombinant

Sign In for Pricing
View Details
Recombinant other B. Microti IRA Protein, His, Insect-1mg
QP11115-1mg 1mg

Recombinant other B. Microti IRA Protein, His, Insect-1mg

Sign In for Pricing
View Details
Recombinant Human Protein FAM205A (FAM205A) , partial
MBS1376935 Inquire

Recombinant Human Protein FAM205A (FAM205A) , partial

Sign In for Pricing
View Details
CD71 discontinued
507885 100 µg

CD71 discontinued

Sign In for Pricing
View Details
4α-Carboxy-cholest-7-en-3β-ol
434219-01 2.5 mg

4α-Carboxy-cholest-7-en-3β-ol

Sign In for Pricing
View Details
4α-Carboxy-cholest-7-en-3β-ol
434219-02 5 mg

4α-Carboxy-cholest-7-en-3β-ol

Sign In for Pricing
View Details