MICA Peptide - middle region
MICA Peptide - middle region
Product Specifications
Product Name Alternative
MIC-A, PERB11.1
UniProt
Q29983
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MICA Rabbit Polyclonal Antibody (orb588885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000238.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0035207-01 20 µL
Monoclonal Antibody to P-Selectin Glycoprotein Ligand 1 (PSGL1)
Sign In for Pricing
View Details TRV-0035207-02 100 µL
Monoclonal Antibody to P-Selectin Glycoprotein Ligand 1 (PSGL1)
Sign In for Pricing
View Details TRV-0035207-03 200 µL
Monoclonal Antibody to P-Selectin Glycoprotein Ligand 1 (PSGL1)
Sign In for Pricing
View Details TRV-0035207-04 1 mL
Monoclonal Antibody to P-Selectin Glycoprotein Ligand 1 (PSGL1)
Sign In for Pricing
View Details 
PB9884-FITC 100 µg/Vial
Anti-Rab9/RAB9A Antibody Picoband® (FITC Conjugate)
Sign In for Pricing
View Details