STMN3 Peptide - middle region
STMN3 Peptide - middle region
Product Specifications
Product Name Alternative
SCLIP
UniProt
Q9NZ72
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STMN3 Rabbit Polyclonal Antibody (orb589027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001263239.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SDLSPESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERR
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2143202 1.0 µg DNA
SHC1P1 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details H-4944.0001 1.0mg
(Deamino-Cys3,Nle4,Arg5,D-2-Nal7,Cys11)-a-MSH (3-11) amide
Sign In for Pricing
View Details 
NBP3-27995G 0.1 mL
Human Monoclonal RHD Antibody (LFB Anti-RhD) [DyLight 488]
Sign In for Pricing
View Details