Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STMN3 Peptide - middle region

STMN3 Peptide - middle region

Product Specifications

Product Name Alternative

SCLIP

UniProt

Q9NZ72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STMN3 Rabbit Polyclonal Antibody (orb589027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001263239.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDLSPESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERR

More Discoveries

Explore Other Products

Browse additional items from our catalog

VOLTAGE MARKERS CV 10000 VOLT D Conduit & Voltage Markers
244759 900 Pack (36 Label (s) x 25 Card)

VOLTAGE MARKERS CV 10000 VOLT D Conduit & Voltage Markers

Sign In for Pricing
View Details
Flamma® 496 Amine
CWE1001_5 mg 5 mg

Flamma® 496 Amine

Sign In for Pricing
View Details
Sheep S100A12 ELISA Kit
ESS0031 96 Tests

Sheep S100A12 ELISA Kit

Sign In for Pricing
View Details
Mouse MCTS2 shRNA Plasmid
abx975591-01 150 µg

Mouse MCTS2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MCTS2 shRNA Plasmid
abx975591-02 300 µg

Mouse MCTS2 shRNA Plasmid

Sign In for Pricing
View Details
RCOR1 Protein Vector (Human) (pPB-N-His)
PV115383 500 ng

RCOR1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details