Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA13 Peptide - middle region

HSPA13 Peptide - middle region

Product Specifications

Product Name Alternative

STCH

UniProt

P48723

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA13 Rabbit Polyclonal Antibody (orb589332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_008879.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cinnamyl alcohol
C22630-01 100 g

Cinnamyl alcohol

Sign In for Pricing
View Details
Cinnamyl alcohol
C22630-02 500 g

Cinnamyl alcohol

Sign In for Pricing
View Details
ZKSCAN5 (NM_145102) Human Tagged ORF Clone
RG215697 10 µg

ZKSCAN5 (NM_145102) Human Tagged ORF Clone

Sign In for Pricing
View Details
Calgranulin B CRISPR/Cas9 KO Plasmid (h2)
sc-400801-KO-2 20 µg

Calgranulin B CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details
Anti-Phosphohistidine Phosphatase 1 (PHPT1) Polyclonal Antibody
CAU36813-01 100 µL

Anti-Phosphohistidine Phosphatase 1 (PHPT1) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phosphohistidine Phosphatase 1 (PHPT1) Polyclonal Antibody
CAU36813-02 200 µL

Anti-Phosphohistidine Phosphatase 1 (PHPT1) Polyclonal Antibody

Sign In for Pricing
View Details