Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D2A Peptide - middle region

SH2D2A Peptide - middle region

Product Specifications

Product Name Alternative

SCAP, TSAD, VRAP, F2771

UniProt

Q9NP31

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH2D2A Rabbit Polyclonal Antibody (orb589340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001154914.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NOG/Noggin Protein, C-Fc
EHG46001 100 μg

Recombinant Human NOG/Noggin Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)
MBS7007035-01 0.02 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)
MBS7007035-02 0.1 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)
MBS7007035-03 5x 0.1 mg

Recombinant Yersinia pseudotuberculosis serotype O:1b Protein AaeX (aaeX)

Sign In for Pricing
View Details
IκB-β (Phospho-Ser23) Polyclonal Conjugated Antibody
orb1630945 100 µL

IκB-β (Phospho-Ser23) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Bromothymol Blue Indicator Solution
0519B 00125 125 mL

Bromothymol Blue Indicator Solution

Sign In for Pricing
View Details