RBMX2 Peptide - middle region
RBMX2 Peptide - middle region
Product Specifications
Product Name Alternative
Snu17, CGI-79
UniProt
Q9Y388
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RBMX2 Rabbit Polyclonal Antibody (orb589342) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_057108.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSR030526 100 µg
Recombinant SARS-CoV-2 Spike Protein (RBD, His Tag) (F342L)
Sign In for Pricing
View Details 
