Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF1D Peptide - middle region

TAF1D Peptide - middle region

Product Specifications

Product Name Alternative

JOSD3, RAFI41, TAFI41, TAF (I) 41

UniProt

Q9H5J8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAF1D Rabbit Polyclonal Antibody (orb589376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_077021.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen V α1 (Cleaved-Ala1605) rabbit pAb
RA23656-01 50 µL

Collagen V α1 (Cleaved-Ala1605) rabbit pAb

Sign In for Pricing
View Details
Collagen V α1 (Cleaved-Ala1605) rabbit pAb
RA23656-02 100 µL

Collagen V α1 (Cleaved-Ala1605) rabbit pAb

Sign In for Pricing
View Details
Rabbit Anti Human ACLY Monoclonal Clone ECF-1 100ug
IRBAHUACLYECF1C100ug 100 µg

Rabbit Anti Human ACLY Monoclonal Clone ECF-1 100ug

Sign In for Pricing
View Details
Adipoq Antibody (Biotin)
orb243432-01 50 µg

Adipoq Antibody (Biotin)

Sign In for Pricing
View Details
Adipoq Antibody (Biotin)
orb243432-02 100 µg

Adipoq Antibody (Biotin)

Sign In for Pricing
View Details
6H05
T1931-01 5 mg

6H05

Sign In for Pricing
View Details