TAF1D Peptide - middle region
TAF1D Peptide - middle region
Product Specifications
Product Name Alternative
JOSD3, RAFI41, TAFI41, TAF (I) 41
UniProt
Q9H5J8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAF1D Rabbit Polyclonal Antibody (orb589376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_077021.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2112108-01 0.1 mL
Polyclonal Antibody to Cluster of Differentiation 59 (CD59)
Sign In for Pricing
View Details