Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR9 Peptide - N-terminal region

CCR9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR28, CDw199, GPR-9-6, CC-CKR-9

UniProt

P51686

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCR9 Rabbit Polyclonal Antibody (orb589402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001243298.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCALD Protein Vector (Human) (pPM-C-HA)
31532021 500 ng

NCALD Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
2-Cyclopentylacetamide
AAA93304-01 0.5 g

2-Cyclopentylacetamide

Sign In for Pricing
View Details
2-Cyclopentylacetamide
AAA93304-02 5 g

2-Cyclopentylacetamide

Sign In for Pricing
View Details
TMC8 AAV Vector (Human) (CMV)
46822101 1 µg

TMC8 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
2-Methyl-2- (2-pyridinyl) -propanedioic Acid
418689 50 mg

2-Methyl-2- (2-pyridinyl) -propanedioic Acid

Sign In for Pricing
View Details
C29F7.3 Antibody
orb800799 2 mg

C29F7.3 Antibody

Sign In for Pricing
View Details