CCR9 Peptide - N-terminal region
CCR9 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GPR28, CDw199, GPR-9-6, CC-CKR-9
UniProt
P51686
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCR9 Rabbit Polyclonal Antibody (orb589402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001243298.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
101921F2-AAT 500 Tests
APC/iFluor® 700 Anti-human CD19 Antibody *HIB19*
Sign In for Pricing
View Details 
MBS6002176-01 0.2 mL
KIAA1644, NT (KIAA1644, Uncharacterized protein KIAA1644)
Sign In for Pricing
View Details MBS6002176-02 5x 0.2 mL
KIAA1644, NT (KIAA1644, Uncharacterized protein KIAA1644)
Sign In for Pricing
View Details 