Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCB4 Peptide - middle region

PLCB4 Peptide - middle region

Product Specifications

Product Name Alternative

ARCND2, PI-PLC

UniProt

Q15147

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLCB4 Rabbit Polyclonal Antibody (orb589022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000924.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALAS

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45997111 3x 1.0 µg

SYT13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human FABP3 Matched Antibody Pair Set [ABP-S-07274]
ABP-S-07274 5 Plates

Human FABP3 Matched Antibody Pair Set [ABP-S-07274]

Sign In for Pricing
View Details
Slc22a29 3'UTR Lenti-reporter-Luc Vector
43957084 1.0 µg

Slc22a29 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CLPP Rabbit mAb
C06072-20uL 20 µL

CLPP Rabbit mAb

Sign In for Pricing
View Details
ATF3 Mouse Monoclonal Antibody [Clone ID: OTI5G9]
TA808558S 30 µL

ATF3 Mouse Monoclonal Antibody [Clone ID: OTI5G9]

Sign In for Pricing
View Details
Dhh (A-12)
sc-133244 200 µg/mL

Dhh (A-12)

Sign In for Pricing
View Details