Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA3 Peptide - middle region

ITGA3 Peptide - middle region

Product Specifications

Product Name Alternative

VL3A, CD49C, FRP-2, GAPB3, ILNEB, MSK18, VCA-2, VLA3a, GAP-B3

UniProt

P26006

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGA3 Rabbit Polyclonal Antibody (orb589030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002195.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2055583-01 0.1 mL

PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2055583-02 0.2 mL

PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2055583-03 0.5 mL

PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2055583-04 1 mL

PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2055583-05 5 mL

PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2055583-06 5x 5 mL

PE-Linked Polyclonal Antibody to Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details