Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA3 Peptide - middle region

ITGA3 Peptide - middle region

Product Specifications

Product Name Alternative

VL3A, CD49C, FRP-2, GAPB3, ILNEB, MSK18, VCA-2, VLA3a, GAP-B3

UniProt

P26006

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGA3 Rabbit Polyclonal Antibody (orb589030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002195.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BASP1 qPCR Primer Pair
QH31369S 200 Tests

Human BASP1 qPCR Primer Pair

Sign In for Pricing
View Details
P53, phosphorylated (Ser20) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (APC) discontinued
P1001-27K1-APC 200 µL

P53, phosphorylated (Ser20) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (APC) discontinued

Sign In for Pricing
View Details
Campylobacter jejuni subsp. doylei Probe-based qPCR Kit
MK1F912-01 48 Test

Campylobacter jejuni subsp. doylei Probe-based qPCR Kit

Sign In for Pricing
View Details
Campylobacter jejuni subsp. doylei Probe-based qPCR Kit
MK1F912-02 50 Tests

Campylobacter jejuni subsp. doylei Probe-based qPCR Kit

Sign In for Pricing
View Details
GLRA1 (Glycine Receptor, alpha 1, MGC138878, MGC138879, STHE) (MaxLight 405) discontinued
246637-ML405 100 µL

GLRA1 (Glycine Receptor, alpha 1, MGC138878, MGC138879, STHE) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Myocilin (Myoc), partial
CSB-EP015356MO-01 10 µg

Recombinant Mouse Myocilin (Myoc), partial

Sign In for Pricing
View Details