Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAK2 Peptide - middle region

TRAK2 Peptide - middle region

Product Specifications

Product Name Alternative

GRIF1, MILT2, OIP98, CALS-C, GRIF-1, ALS2CR3

UniProt

O60296

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAK2 Rabbit Polyclonal Antibody (orb589061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055864.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLLNQGSSSEEVAGSSQKMGQPGPSGDSDLATALHRLSLRRQNYLSEKQF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gas8 Rat shRNA Lentiviral Particle (Locus ID 361438)
TL703615V 500 µL Each

Gas8 Rat shRNA Lentiviral Particle (Locus ID 361438)

Sign In for Pricing
View Details
LDLR sgRNA CRISPR Lentivector set (Human)
K1205901 3x 1.0 µg

LDLR sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (AP) discontinued
138061-AP 100 µL

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UPF0176 protein PD_1985 (PD_1985)
MBS1378980-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa UPF0176 protein PD_1985 (PD_1985)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UPF0176 protein PD_1985 (PD_1985)
MBS1378980-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa UPF0176 protein PD_1985 (PD_1985)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa UPF0176 protein PD_1985 (PD_1985)
MBS1378980-03 0.02 mg (Yeast)

Recombinant Xylella fastidiosa UPF0176 protein PD_1985 (PD_1985)

Sign In for Pricing
View Details