Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAK2 Peptide - middle region

TRAK2 Peptide - middle region

Product Specifications

Product Name Alternative

GRIF1, MILT2, OIP98, CALS-C, GRIF-1, ALS2CR3

UniProt

O60296

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAK2 Rabbit Polyclonal Antibody (orb589061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055864.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLLNQGSSSEEVAGSSQKMGQPGPSGDSDLATALHRLSLRRQNYLSEKQF

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOD1 (147-153) human
TP2831-01 10 mg

SOD1 (147-153) human

Sign In for Pricing
View Details
SOD1 (147-153) human
TP2831-02 50 mg

SOD1 (147-153) human

Sign In for Pricing
View Details
DMEM/F-12 Medium (1x)
TBS8083C 500 mL

DMEM/F-12 Medium (1x)

Sign In for Pricing
View Details
ZNF264 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E9]
TA810501BM 100 µL

ZNF264 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E9]

Sign In for Pricing
View Details
CBX5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
15145061 1.0 µg DNA

CBX5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Rickettsia bellii DNA gyrase subunit A (gyrA), partial
MBS1398939 Inquire

Recombinant Rickettsia bellii DNA gyrase subunit A (gyrA), partial

Sign In for Pricing
View Details