GEMIN2 Peptide - middle region
GEMIN2 Peptide - middle region
Product Specifications
Product Name Alternative
SIP1, SIP1-delta
UniProt
O14893
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GEMIN2 Rabbit Polyclonal Antibody (orb589346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001009182.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEK
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal HINT3 Antibody [Alexa Fluor 594]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-97827AF594 0.1 mL
Rabbit Polyclonal HINT3 Antibody [Alexa Fluor 594]
Sign In for Pricing
View Details 
MBS7006940-01 0.02 mg
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)
Sign In for Pricing
View Details 
MBS7006940-02 0.1 mg
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)
Sign In for Pricing
View Details MBS7006940-03 5x 0.1 mg
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)
Sign In for Pricing
View Details