Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM219B Peptide - middle region

FAM219B Peptide - middle region

Product Specifications

Product Name Alternative

C15orf17

UniProt

Q5XKK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM219B Rabbit Polyclonal Antibody (orb55797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065180.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP16 Knockout HT29 Polyclonal Cells
ARG14444 1 Million

PARP16 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Olr1156 siRNA Oligos set (Rat)
33711176 3x 5 nmol

Olr1156 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
IBGC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV729101 1.0 µg DNA

IBGC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZNF295 (ZBTB21) (NM_001098403) Human Tagged ORF Clone Lentiviral Particle
RC224673L3V 200 µL

ZNF295 (ZBTB21) (NM_001098403) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC25A40 3'UTR Luciferase Stable Cell Line
TU023518 1.0 mL

SLC25A40 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NLRP3 Protein Vector (Mouse) (pPB-C-His)
PV205778 500 ng

NLRP3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details