Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM219B Peptide - middle region

FAM219B Peptide - middle region

Product Specifications

Product Name Alternative

C15orf17

UniProt

Q5XKK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM219B Rabbit Polyclonal Antibody (orb55797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065180.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itih1 (BC028814) Mouse Tagged ORF Clone Lentiviral Particle
MR211152L4V 200 µL

Itih1 (BC028814) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AdmiRa-hsa-miR-1324-Off Virus
mh5168 1.0 mL

AdmiRa-hsa-miR-1324-Off Virus

Sign In for Pricing
View Details
Rabbit Polyclonal DOK3 Antibody [Alexa Fluor 647]
NBP2-99574AF647 0.1 mL

Rabbit Polyclonal DOK3 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
ELOVL5 Antibody Blocking Peptide
orb1502282 500 µg

ELOVL5 Antibody Blocking Peptide

Sign In for Pricing
View Details
Olr1652 (NM_001001122) Rat Tagged ORF Clone Lentiviral Particle
RR214332L3V 200 µL

Olr1652 (NM_001001122) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RRS1 Protein Vector (Human) (pPM-C-His)
PV036400 500 ng

RRS1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details