Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB2 Peptide - middle region

MOB2 Peptide - middle region

Product Specifications

Product Name Alternative

HCCA2

UniProt

Q70IA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB2 Rabbit Polyclonal Antibody (orb589373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001165694.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLQYSTISEFCTGETCQTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPSA Antibody [mFluor Violet 450 SE]
NBP2-41246MFV450 0.1 mL

Rabbit Polyclonal RPSA Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Phospho-YB1 (Ser102) Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-3477R-PE-Cy5.5 100 µL

Phospho-YB1 (Ser102) Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Chlormidazole hydrochloride
ZCA29863-01 250 mg

Chlormidazole hydrochloride

Sign In for Pricing
View Details
Chlormidazole hydrochloride
ZCA29863-02 2.5 g

Chlormidazole hydrochloride

Sign In for Pricing
View Details
4-Pyridineboronic Acid
TRC-P991355-100G 100 g

4-Pyridineboronic Acid

Sign In for Pricing
View Details
Lrfn1 3'UTR GFP Stable Cell Line
TU162557 1.0 mL

Lrfn1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details