Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIBCH Peptide - middle region

HIBCH Peptide - middle region

Product Specifications

Product Name Alternative

HIBYLCOAH

UniProt

Q6NVY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIBCH Rabbit Polyclonal Antibody (orb589386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055177.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAM

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL20 Mouse Monoclonal Antibody [Clone ID: OTI5E10]
TA803409S 30 µL

IL20 Mouse Monoclonal Antibody [Clone ID: OTI5E10]

Sign In for Pricing
View Details
Nori® Chicken MMP-3 ELISA Kit
GR114159 96 Well

Nori® Chicken MMP-3 ELISA Kit

Sign In for Pricing
View Details
Nitrotetrazoliumbluechloride
abx082368-01 100 mg

Nitrotetrazoliumbluechloride

Sign In for Pricing
View Details
Nitrotetrazoliumbluechloride
abx082368-02 1000 mg

Nitrotetrazoliumbluechloride

Sign In for Pricing
View Details
Amikacin hydrate
C09133-50mg 50 mg

Amikacin hydrate

Sign In for Pricing
View Details
Research Grade Anti-Human CD172a/SIRPA (ES004)
MBS1581450-01 0.1 mg

Research Grade Anti-Human CD172a/SIRPA (ES004)

Sign In for Pricing
View Details