Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIBCH Peptide - middle region

HIBCH Peptide - middle region

Product Specifications

Product Name Alternative

HIBYLCOAH

UniProt

Q6NVY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIBCH Rabbit Polyclonal Antibody (orb589386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055177.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk12 (NM_001109628) Mouse Tagged ORF Clone
MR215624 10 µg

Cdk12 (NM_001109628) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human NG2/MCSP MAb (Clone LHM-2)
MAB2585-SP 25 µg

Human NG2/MCSP MAb (Clone LHM-2)

Sign In for Pricing
View Details
Anti-VCL Polyclonal Antibody
HB090014-01 50 µg

Anti-VCL Polyclonal Antibody

Sign In for Pricing
View Details
Anti-VCL Polyclonal Antibody
HB090014-02 100 µg

Anti-VCL Polyclonal Antibody

Sign In for Pricing
View Details
pLV3-U6-NAT10-shRNA2-Puro Plasmid
PVT50091 2 µg

pLV3-U6-NAT10-shRNA2-Puro Plasmid

Sign In for Pricing
View Details
SNORD36C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2227807 1.0 µg DNA

SNORD36C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details