Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POMC Peptide - middle region

POMC Peptide - middle region

Product Specifications

Product Name Alternative

LPH, MSH, NPP, POC, ACTH, CLIP

UniProt

P01189

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POMC Rabbit Polyclonal Antibody (orb589395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000930.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B1 Antibody
OACD04299-1ML 1 mL

HSD17B1 Antibody

Sign In for Pricing
View Details
ITI-H4 (G-2) Alexa Fluor® 647
sc-515060 AF647 200 µg/mL

ITI-H4 (G-2) Alexa Fluor® 647

Sign In for Pricing
View Details
LAMP2, ID (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD107b)
037672 200 µL

LAMP2, ID (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD107b)

Sign In for Pricing
View Details
TRMT10A siRNA (Rat)
MBS8239691-01 15 nmol

TRMT10A siRNA (Rat)

Sign In for Pricing
View Details
TRMT10A siRNA (Rat)
MBS8239691-02 30 nmol

TRMT10A siRNA (Rat)

Sign In for Pricing
View Details
TRMT10A siRNA (Rat)
MBS8239691-03 5x 30 nmol

TRMT10A siRNA (Rat)

Sign In for Pricing
View Details