Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIK3R2 Peptide - N-terminal region

PIK3R2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P85, MPPH, P85B, MPPH1, p85-BETA

UniProt

O00459

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIK3R2 Rabbit Polyclonal Antibody (orb589396) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005018.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSPPDVAPPLLVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inpp5f sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
24985114 3x 1.0 µg

Inpp5f sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
AMPA receptor modulator-7
orb3133276-01 50 mg

AMPA receptor modulator-7

Sign In for Pricing
View Details
AMPA receptor modulator-7
orb3133276-02 10 mg

AMPA receptor modulator-7

Sign In for Pricing
View Details
EIF3J Antibody, HRP conjugated
CSB-PA007539LB01HU-01 50 µg

EIF3J Antibody, HRP conjugated

Sign In for Pricing
View Details
EIF3J Antibody, HRP conjugated
CSB-PA007539LB01HU-02 100 µg

EIF3J Antibody, HRP conjugated

Sign In for Pricing
View Details
ASS1 Mouse Monoclonal Antibody [Clone:8C4]
E45M18793 100 µg

ASS1 Mouse Monoclonal Antibody [Clone:8C4]

Sign In for Pricing
View Details