LRRN4 Peptide - N-terminal region
LRRN4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NLRR4, NLRR-4, C20orf75, dJ1056H1.1
UniProt
Q8WUT4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRN4 Rabbit Polyclonal Antibody (orb589436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_689824.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PLLLLTVLRPSWADPPQEKVPLFRVTQQGPWGSSGSNATDSPCEGLPAAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSQ050034-01 10 µg
Recombinant Cynomolgus CSF1R/CD115 Protein (His Tag)
Sign In for Pricing
View Details PKSQ050034-02 50 µg
Recombinant Cynomolgus CSF1R/CD115 Protein (His Tag)
Sign In for Pricing
View Details ![MOBKL2B (MOB3B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6E3]](https://cdn.genprice.uk/products/937/68dd1b67061270361ea14bac/imageurl/ta501503bm.webp)
TA501503BM 100 µL
MOBKL2B (MOB3B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6E3]
Sign In for Pricing
View Details 
HA725042B 100 µL
Mouse CCL2 / MCP-1 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
BNC740210-500 1x 500 µL
Giardia lamblia (BB1.1E5), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details