LRRN4 Peptide - N-terminal region
LRRN4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NLRR4, NLRR-4, C20orf75, dJ1056H1.1
UniProt
Q8WUT4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRN4 Rabbit Polyclonal Antibody (orb589436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_689824.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PLLLLTVLRPSWADPPQEKVPLFRVTQQGPWGSSGSNATDSPCEGLPAAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941727-500 1x 500 µL
S100B (Astrocyte and Melanoma Marker), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
