IL21R Peptide - middle region
IL21R Peptide - middle region
Product Specifications
Product Name Alternative
NILR, CD360
UniProt
Q9HBE5
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL21R Rabbit Polyclonal Antibody (orb589443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_068570.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0024823-01 100 µL
Biotin-Linked Polyclonal Antibody to Visual System Homeobox Protein 2 (VSX2)
Sign In for Pricing
View Details TRV-0024823-02 200 µL
Biotin-Linked Polyclonal Antibody to Visual System Homeobox Protein 2 (VSX2)
Sign In for Pricing
View Details 
MBS6368938-01 0.1 mL
ADORA2A (Adenosine Receptor A2a, ADORA2) (HRP)
Sign In for Pricing
View Details MBS6368938-02 5x 0.1 mL
ADORA2A (Adenosine Receptor A2a, ADORA2) (HRP)
Sign In for Pricing
View Details