Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL21R Peptide - middle region

IL21R Peptide - middle region

Product Specifications

Product Name Alternative

NILR, CD360

UniProt

Q9HBE5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL21R Rabbit Polyclonal Antibody (orb589443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_068570.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT16 (N-Term) Antibody
orb2630604 100 µL

NAT16 (N-Term) Antibody

Sign In for Pricing
View Details
Olr1319 Protein Vector (Rat) (pPM-C-HA)
PV287764 500 ng

Olr1319 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PLV3-U6-EGFR-3UTR-shRNA3-CopGFP-Puro Plasmid
PVT74946 2 µg

PLV3-U6-EGFR-3UTR-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Bovine RAB6-interacting golgin, GORAB ELISA Kit
MBS9327958-01 48 Well

Bovine RAB6-interacting golgin, GORAB ELISA Kit

Sign In for Pricing
View Details
Bovine RAB6-interacting golgin, GORAB ELISA Kit
MBS9327958-02 96 Well

Bovine RAB6-interacting golgin, GORAB ELISA Kit

Sign In for Pricing
View Details
Bovine RAB6-interacting golgin, GORAB ELISA Kit
MBS9327958-03 5x 96 Well

Bovine RAB6-interacting golgin, GORAB ELISA Kit

Sign In for Pricing
View Details