Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM23 Peptide - C-terminal region

TIMM23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TIM23

UniProt

O14925

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006318.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDB1 And CUL4 Associated Factor 7 (DCAF7) Antibody
abx005207-01 20 µL

DDB1 And CUL4 Associated Factor 7 (DCAF7) Antibody

Sign In for Pricing
View Details
DDB1 And CUL4 Associated Factor 7 (DCAF7) Antibody
abx005207-02 100 µL

DDB1 And CUL4 Associated Factor 7 (DCAF7) Antibody

Sign In for Pricing
View Details
DDB1 And CUL4 Associated Factor 7 (DCAF7) Antibody
abx005207-03 2x 100 µL

DDB1 And CUL4 Associated Factor 7 (DCAF7) Antibody

Sign In for Pricing
View Details
Mouse Myotrophin (MTPN) ELISA Kit
MBS2706436-01 24 Strip Well

Mouse Myotrophin (MTPN) ELISA Kit

Sign In for Pricing
View Details
Mouse Myotrophin (MTPN) ELISA Kit
MBS2706436-02 48 Well

Mouse Myotrophin (MTPN) ELISA Kit

Sign In for Pricing
View Details
Mouse Myotrophin (MTPN) ELISA Kit
MBS2706436-03 96 Well

Mouse Myotrophin (MTPN) ELISA Kit

Sign In for Pricing
View Details