TIMM23 Peptide - C-terminal region
TIMM23 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TIM23
UniProt
O14925
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006318.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1344277-01 0.02 mg (E-Coli)
Recombinant Nitrosococcus oceani Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1344277-02 0.1 mg (E-Coli)
Recombinant Nitrosococcus oceani Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1344277-03 0.02 mg (Yeast)
Recombinant Nitrosococcus oceani Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1344277-04 0.1 mg (Yeast)
Recombinant Nitrosococcus oceani Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1344277-05 0.02 mg (Baculovirus)
Recombinant Nitrosococcus oceani Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1344277-06 0.02 mg (Mammalian-Cell)
Recombinant Nitrosococcus oceani Ribonuclease 3 (rnc)
Sign In for Pricing
View Details