APOC3 Peptide - middle region
APOC3 Peptide - middle region
Product Specifications
Product Name Alternative
HALP2, APOCIII
UniProt
P02656
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000031.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2877006 100 µL
MPI/Mannose Phosphate Isomerase Rabbit pAb, PE-Cy7 conjugated
Sign In for Pricing
View Details 
GTR15188976 1 Vial
Lentiviral mouse Cnnm1 shRNA (UAS) - Lentiviral mouse Cnnm1 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details GTR15305974 1 Vial
Lentiviral mouse Rhox6 shRNA (UAS) - Lentiviral mouse Rhox6 shRNA (UAS) plasmid
Sign In for Pricing
View Details 055305-01 10 µg
Discs, Large Homolog 4 (DLG4), Recombinant, Mouse, His-Tag
Sign In for Pricing
View Details 055305-02 50 µg
Discs, Large Homolog 4 (DLG4), Recombinant, Mouse, His-Tag
Sign In for Pricing
View Details 055305-03 100 µg
Discs, Large Homolog 4 (DLG4), Recombinant, Mouse, His-Tag
Sign In for Pricing
View Details