Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC47A1 Peptide - N-terminal region

SLC47A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MATE1

UniProt

Q96FL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060712.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBM46 activation kit by CRISPRa
GA116149 1 Kit

Human RBM46 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 GOM1,  30nm
GM-202-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 GOM1, 30nm

Sign In for Pricing
View Details
Human GIPC3 activation kit by CRISPRa
GA114936 1 Kit

Human GIPC3 activation kit by CRISPRa

Sign In for Pricing
View Details
CLPSL1 Human Gene Knockout Kit (CRISPR)
KN422081 1 Kit

CLPSL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human FAM171B/KIAA1946 Protein (His Tag)
PKSH030562 100 µg

Recombinant Human FAM171B/KIAA1946 Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]
TA500015BM 100 µL

Cytokeratin 18 (KRT18) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]

Sign In for Pricing
View Details