Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC47A1 Peptide - N-terminal region

SLC47A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MATE1

UniProt

Q96FL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060712.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS628985 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
1190005I06Rik (NM_197988) Mouse Tagged ORF Clone
MG200045 10 µg

1190005I06Rik (NM_197988) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ENSA (NM_207042) Human Over-expression Lysate
LC404105 20 µg

ENSA (NM_207042) Human Over-expression Lysate

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF740 conjugate, 0.1mg/mL
BNC743081-500 1x 500 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Brain
CS629815 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details
Mouse Grid1 activation kit by CRISPRa
GA201734 1 Kit

Mouse Grid1 activation kit by CRISPRa

Sign In for Pricing
View Details