What is the catalog number for TSR2 Peptide - middle region?

The catalog number for TSR2 Peptide - middle region is orb2000516.

What sizes are available for TSR2 Peptide - middle region?

TSR2 Peptide - middle region is available in the following size(s): 100 µg.

Is TSR2 Peptide - middle region in stock?

TSR2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TSR2 Peptide - middle region

Product Specifications

Product Name Alternative

WGG1, DBA14, DT1P1A10

UniProt

Q969E8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_477511.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNADLELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-99232MFV500 0.1 mL

Rabbit Polyclonal SLITRK1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing

View Details

E20-60514 100 µg

NOS3 (phospho Ser1177) Polyclonal Antibody

Sign In for Pricing

View Details

orb310027-01 50 μL

CYCS Monoclonal Antibody

Sign In for Pricing

View Details

orb310027-02 100 µL

CYCS Monoclonal Antibody

Sign In for Pricing

View Details

RC224857L2 10 µg

SLC30A5 (NM_022902) Human Tagged Lenti ORF Clone

Sign In for Pricing

View Details

OR1049400-01 100 mg

N-Ethyl-1-methylpiperidin-4-amine dihydrochloride

Sign In for Pricing

View Details