Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSR2 Peptide - middle region

TSR2 Peptide - middle region

Product Specifications

Product Name Alternative

WGG1, DBA14, DT1P1A10

UniProt

Q969E8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_477511.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNADLELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-HMGCS1-shRNA1-CopGFP-Puro Plasmid
PVT77298 2 µg

PLV3-U6-HMGCS1-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Endoglin/CD105 Antibody (MEM-226) [Janelia Fluor 646]
NB500-452JF646 0.1 mL

Mouse Monoclonal Endoglin/CD105 Antibody (MEM-226) [Janelia Fluor 646]

Sign In for Pricing
View Details
Human Osteopontin (OPN) Antibody (Biotin Conjugate)
19825-05021 150 µg

Human Osteopontin (OPN) Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
Recombinant Human DNASE1L2 Protein, N-His
orb2832129-01 20 µg

Recombinant Human DNASE1L2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DNASE1L2 Protein, N-His
orb2832129-02 50 µg

Recombinant Human DNASE1L2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DNASE1L2 Protein, N-His
orb2832129-03 100 µg

Recombinant Human DNASE1L2 Protein, N-His

Sign In for Pricing
View Details