RNASEH2B Peptide - middle region
RNASEH2B Peptide - middle region
Product Specifications
Product Name Alternative
AGS2, DLEU8
UniProt
Q5TBB1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001135751.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9943032-01 48 Well
Rat Double Stranded DNA Antibody IgG (dsDNA-IgG) ELISA Kit
Sign In for Pricing
View Details MBS9943032-02 96 Well
Rat Double Stranded DNA Antibody IgG (dsDNA-IgG) ELISA Kit
Sign In for Pricing
View Details MBS9943032-03 5x 96 Well
Rat Double Stranded DNA Antibody IgG (dsDNA-IgG) ELISA Kit
Sign In for Pricing
View Details MBS9943032-04 10x 96 Well
Rat Double Stranded DNA Antibody IgG (dsDNA-IgG) ELISA Kit
Sign In for Pricing
View Details 
12-90361B-100 100 µg
Biotinylated Anti-4-1BB (urelumab biosimilar) mAb
Sign In for Pricing
View Details