Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASEH2B Peptide - middle region

RNASEH2B Peptide - middle region

Product Specifications

Product Name Alternative

AGS2, DLEU8

UniProt

Q5TBB1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135751.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACBD4 (NM_001135705) Human Recombinant Protein
E45H33255M5 20 µg

ACBD4 (NM_001135705) Human Recombinant Protein

Sign In for Pricing
View Details
Nucleolin (PT0100R) PT® Rabbit mAb
YM8522-01 40 µL

Nucleolin (PT0100R) PT® Rabbit mAb

Sign In for Pricing
View Details
Nucleolin (PT0100R) PT® Rabbit mAb
YM8522-02 100 μL

Nucleolin (PT0100R) PT® Rabbit mAb

Sign In for Pricing
View Details
Nucleolin (PT0100R) PT® Rabbit mAb
YM8522-03 200 μL

Nucleolin (PT0100R) PT® Rabbit mAb

Sign In for Pricing
View Details
GNG10 Knockout Hela Polyclonal Cells
ARG25449 1 Million

GNG10 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
RGD1311517 Protein Vector (Rat) (pPM-C-His)
PV299957 500 ng

RGD1311517 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details