Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATXN1 Peptide - N-terminal region

ATXN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATX1, SCA1, D6S504E

UniProt

P54253

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000323.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAWLPGNPGGRGHGGGRHGPAGTSVELGLQQGIGLHKALSTGLDYSPPSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR10a Human qPCR Primer Pair (MI0000266)
HP300028 200 Reactions

MIR10a Human qPCR Primer Pair (MI0000266)

Sign In for Pricing
View Details
TPM4 Human Gene Knockout Kit (CRISPR)
KN401133 1 Kit

TPM4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACSL1 (NM_001995) Human Over-expression Lysate
LC419599 20 µg

ACSL1 (NM_001995) Human Over-expression Lysate

Sign In for Pricing
View Details
PAH Human Gene Knockout Kit (CRISPR)
KN204694BN 1 Kit

PAH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAPK6 Rabbit Polyclonal Antibody
AP01240PU-N 100 µg

MAPK6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Phenyl-1H-1,2,3-triazole
TRC-P400108-500MG 500 mg

5-Phenyl-1H-1,2,3-triazole

Sign In for Pricing
View Details