SH3BGRL3 Peptide - middle region
SH3BGRL3 Peptide - middle region
Product Specifications
Product Name Alternative
TIP-B1, SH3BP-1, HEL-S-297
UniProt
Q9H299
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_112576.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9909141-01 48 Well
Mouse Ubiquitin Carboxyl Terminal Hydrolase 20 (USP20) ELISA Kit
Sign In for Pricing
View Details 
MBS9909141-02 96 Well
Mouse Ubiquitin Carboxyl Terminal Hydrolase 20 (USP20) ELISA Kit
Sign In for Pricing
View Details MBS9909141-03 5x 96 Well
Mouse Ubiquitin Carboxyl Terminal Hydrolase 20 (USP20) ELISA Kit
Sign In for Pricing
View Details MBS9909141-04 10x 96 Well
Mouse Ubiquitin Carboxyl Terminal Hydrolase 20 (USP20) ELISA Kit
Sign In for Pricing
View Details