Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC1B Peptide - middle region

SMC1B Peptide - middle region

Product Specifications

Product Name Alternative

SMC1L2, SMC1BETA

UniProt

Q8NDV3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278430.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCB Antibody
CSB-PA018700GA01HU 100 µL

PRKCB Antibody

Sign In for Pricing
View Details
Anti-Gsta3 Antibody Picoband®, Cy3 Conjugate
A05829-3-Cy3 100 µg/Vial

Anti-Gsta3 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
SLC22A5 Rabbit Polyclonal Antibody (Biotin)
orb2093719 100 µL

SLC22A5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
VirD2 Antibody (Biotin)
orb240383-01 50 µg

VirD2 Antibody (Biotin)

Sign In for Pricing
View Details
VirD2 Antibody (Biotin)
orb240383-02 100 µg

VirD2 Antibody (Biotin)

Sign In for Pricing
View Details
IgG, Fc (FITC)
218727 500 µg

IgG, Fc (FITC)

Sign In for Pricing
View Details