Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC1B Peptide - middle region

SMC1B Peptide - middle region

Product Specifications

Product Name Alternative

SMC1L2, SMC1BETA

UniProt

Q8NDV3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278430.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIKAKENTSHHLKKLDVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)
TRV-0060951-01 20 µL

Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)
TRV-0060951-02 100 µL

Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)
TRV-0060951-03 200 µL

Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)
TRV-0060951-04 1 mL

Monoclonal Antibody to Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2)

Sign In for Pricing
View Details
CES2 Rabbit pAb, BF700 conjugated
orb2875949 100 µL

CES2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Survivin Recombinant Rabbit mAb, BF750 conjugated
orb2347799 100 µL

Survivin Recombinant Rabbit mAb, BF750 conjugated

Sign In for Pricing
View Details