Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BORA Peptide - middle region

BORA Peptide - middle region

Product Specifications

Product Name Alternative

C13orf34

UniProt

Q6PGQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273675.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Itgb6 shRNA (UAS) - Lentiviral mouse Itgb6 shRNA (UAS, iRFP) (25)
GTR15290990 1 Vial

Lentiviral mouse Itgb6 shRNA (UAS) - Lentiviral mouse Itgb6 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
NFS1 Protein Vector (Rat) (pPB-N-His)
PV285127 500 ng

NFS1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
PDE11A
CSB-CL875726HU 10 μg Plasmid + 200 μL Glycerol

PDE11A

Sign In for Pricing
View Details
CD38 Antibody
orb1326108 100 µg

CD38 Antibody

Sign In for Pricing
View Details
Chlormadinone acetate
HY-B1095-01 100 mg

Chlormadinone acetate

Sign In for Pricing
View Details
Chlormadinone acetate
HY-B1095-02 10 mM - 1 mL

Chlormadinone acetate

Sign In for Pricing
View Details