Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BORA Peptide - middle region

BORA Peptide - middle region

Product Specifications

Product Name Alternative

C13orf34

UniProt

Q6PGQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273675.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)
MBS7032733-01 0.02 mg

Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)

Sign In for Pricing
View Details
Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)
MBS7032733-02 0.1 mg

Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)

Sign In for Pricing
View Details
Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)
MBS7032733-03 5x 0.1 mg

Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)

Sign In for Pricing
View Details
Recombinant Human Afamin Protein
orb3002256-01 10 µg

Recombinant Human Afamin Protein

Sign In for Pricing
View Details
Recombinant Human Afamin Protein
orb3002256-02 50 µg

Recombinant Human Afamin Protein

Sign In for Pricing
View Details
Recombinant Human Afamin Protein
orb3002256-03 500 µg

Recombinant Human Afamin Protein

Sign In for Pricing
View Details