Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHG6 Peptide - middle region

PLEKHG6 Peptide - middle region

Product Specifications

Product Name Alternative

MyoGEF

UniProt

Q3KR16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138328.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKLKAEEYVQQKRELLTLYRDQDRESPSTRPSTPSLEGSQSSAEGRTPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Forkhead box protein F2, FOXF2 ELISA Kit
MBS9317054-01 48 Well

Mouse Forkhead box protein F2, FOXF2 ELISA Kit

Sign In for Pricing
View Details
Mouse Forkhead box protein F2, FOXF2 ELISA Kit
MBS9317054-02 96 Well

Mouse Forkhead box protein F2, FOXF2 ELISA Kit

Sign In for Pricing
View Details
Mouse Forkhead box protein F2, FOXF2 ELISA Kit
MBS9317054-03 5x 96 Well

Mouse Forkhead box protein F2, FOXF2 ELISA Kit

Sign In for Pricing
View Details
Mouse Forkhead box protein F2, FOXF2 ELISA Kit
MBS9317054-04 10x 96 Well

Mouse Forkhead box protein F2, FOXF2 ELISA Kit

Sign In for Pricing
View Details
Lck, p56, (Non-receptor Protein Tyrosine Kinase) discontinued
L1565-17 100 µg

Lck, p56, (Non-receptor Protein Tyrosine Kinase) discontinued

Sign In for Pricing
View Details
Human IL18 ELISA Kit
E019393 1 Each

Human IL18 ELISA Kit

Sign In for Pricing
View Details