Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHG6 Peptide - middle region

PLEKHG6 Peptide - middle region

Product Specifications

Product Name Alternative

MyoGEF

UniProt

Q3KR16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138328.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKLKAEEYVQQKRELLTLYRDQDRESPSTRPSTPSLEGSQSSAEGRTPEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macurin (Standard)
HY-N3347R 1 Each

Macurin (Standard)

Sign In for Pricing
View Details
FBXL18 Antibody
CSB-PA008469LA01HU-01 50 µg

FBXL18 Antibody

Sign In for Pricing
View Details
FBXL18 Antibody
CSB-PA008469LA01HU-02 100 µg

FBXL18 Antibody

Sign In for Pricing
View Details
Baohuoside I
S3840-25mg 25 mg

Baohuoside I

Sign In for Pricing
View Details
WBP2NL Protein Vector (Mouse) (pPB-C-His)
PV246862 500 ng

WBP2NL Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Hepassocin Antibody
OM636546-01 100 µL

Hepassocin Antibody

Sign In for Pricing
View Details