Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD6 Peptide - N-terminal region

MFSD6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MMR2, hMMR2

UniProt

Q6ZSS7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060164.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Histone H2B (AcK125) Antibody
MBS4513674-01 0.05 mL

Rabbit anti-Histone H2B (AcK125) Antibody

Sign In for Pricing
View Details
Rabbit anti-Histone H2B (AcK125) Antibody
MBS4513674-02 0.1 mL

Rabbit anti-Histone H2B (AcK125) Antibody

Sign In for Pricing
View Details
Rabbit anti-Histone H2B (AcK125) Antibody
MBS4513674-03 5x 0.1 mL

Rabbit anti-Histone H2B (AcK125) Antibody

Sign In for Pricing
View Details
IGFBP3 antibody
70R-35863 0.1 mg

IGFBP3 antibody

Sign In for Pricing
View Details
Mouse Anti-S. equi EAG Antibody, IgG2b kappa (MOFY-0922-FY198)
MOFY-0922-FY198 Each

Mouse Anti-S. equi EAG Antibody, IgG2b kappa (MOFY-0922-FY198)

Sign In for Pricing
View Details
Polyclonal Anti-APEX1 Antibody
GWB-BBP371 0.1 mg

Polyclonal Anti-APEX1 Antibody

Sign In for Pricing
View Details