MFSD6 Peptide - N-terminal region
MFSD6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MMR2, hMMR2
UniProt
Q6ZSS7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060164.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7226952-01 48 Well
Chicken Transcription factor MafK (MAFK) ELISA Kit
Sign In for Pricing
View Details MBS7226952-02 96 Well
Chicken Transcription factor MafK (MAFK) ELISA Kit
Sign In for Pricing
View Details MBS7226952-03 5x 96 Well
Chicken Transcription factor MafK (MAFK) ELISA Kit
Sign In for Pricing
View Details MBS7226952-04 10x 96 Well
Chicken Transcription factor MafK (MAFK) ELISA Kit
Sign In for Pricing
View Details 301420-ML750 100 µL
NFATc1 (NFATc-1, Nuclear Factor of Activated T-cells c1, NFATc 1) (MaxLight 750) discontinued
Sign In for Pricing
View Details