Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPMT1 Peptide - N-terminal region

PTPMT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MOSP, PLIP, DUSP23, PNAS-129

UniProt

Q8WUK0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137456.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1AN (NM_017902) Human Over-expression Lysate
LY402628 100 µg

HIF1AN (NM_017902) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Dopamine Receptor D1 Antibody
RC-15557-01 50 μL

Recombinant Dopamine Receptor D1 Antibody

Sign In for Pricing
View Details
Recombinant Dopamine Receptor D1 Antibody
RC-15557-02 100 µL

Recombinant Dopamine Receptor D1 Antibody

Sign In for Pricing
View Details
Recombinant Dopamine Receptor D1 Antibody
RC-15557-03 1 mL

Recombinant Dopamine Receptor D1 Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Syrian Hamster IgG Isotype Control[SHG-1]
E-AB-F09763Q-01 25 µg

Elab Fluor® Violet 450 Syrian Hamster IgG Isotype Control[SHG-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Syrian Hamster IgG Isotype Control[SHG-1]
E-AB-F09763Q-02 100 µg

Elab Fluor® Violet 450 Syrian Hamster IgG Isotype Control[SHG-1]

Sign In for Pricing
View Details