Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPMT1 Peptide - N-terminal region

PTPMT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MOSP, PLIP, DUSP23, PNAS-129

UniProt

Q8WUK0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137456.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D3]
TA502797BM 100 µL

FGFR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D3]

Sign In for Pricing
View Details
Clusterin (CLU) Rabbit Monoclonal Antibody [Clone ID: SAIC-43B-8]
TA385915 200 µg

Clusterin (CLU) Rabbit Monoclonal Antibody [Clone ID: SAIC-43B-8]

Sign In for Pricing
View Details
CHCHD10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D7]
TA811808AM 100 µL

CHCHD10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D7]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS508697 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF640R conjugate, 0.1mg/mL
BNC402884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLK2 Mouse Monoclonal Antibody [Clone ID: OTI2H2]
CF805492 100 µg

TLK2 Mouse Monoclonal Antibody [Clone ID: OTI2H2]

Sign In for Pricing
View Details