Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAO Peptide - middle region

DAO Peptide - middle region

Product Specifications

Product Name Alternative

DAAO, OXDA, DAMOX

UniProt

P14920

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001908.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BRN3C Antibody
MBS822202-01 0.03 mL

Anti-BRN3C Antibody

Sign In for Pricing
View Details
Anti-BRN3C Antibody
MBS822202-02 0.05 mL

Anti-BRN3C Antibody

Sign In for Pricing
View Details
Anti-BRN3C Antibody
MBS822202-03 0.1 mL

Anti-BRN3C Antibody

Sign In for Pricing
View Details
Anti-BRN3C Antibody
MBS822202-04 0.2 mL

Anti-BRN3C Antibody

Sign In for Pricing
View Details
Anti-BRN3C Antibody
MBS822202-05 5x 0.2 mL

Anti-BRN3C Antibody

Sign In for Pricing
View Details
ABAT siRNA (Rat)
orb1831649-01 15 nmol

ABAT siRNA (Rat)

Sign In for Pricing
View Details